Menu
Your Cart

All Products

  Synonyms: ACE-031, Myostatin inhibitory peptide 7 Sequence:  AWRQNTRYSRIEAIKIQILSKLRLIUPAC Condensed: H-Ala-Trp-Arg-Gln-Asn-Thr-Arg-Tyr-Ser-Arg-Ile-Glu-Ala-Ile-Lys-Ile-Gln-Ile-Leu-Ser-Lys-Leu-Arg-Leu-NH2 Molecular Weight: 2956.5g/mol CAS Numbe..
£66.00
Ex Tax:£55.00
Similar to Ethanol and water, Acetic Acid is a protic (polar) solvent. This means that it dissolves both polar compounds, like salts and sugars, but also non-polar compounds, such as oils.Peptide solubility characteristics vary strongly from one peptide to another. Residues such as Ala, Cys, Ile, Le..
£11.99
Ex Tax:£9.99
 Synonyms: Adipotide, FTPP Sequence:  CKGGRAKDC-GG-D(KLAKLAK)2 Molecular Weight: 2611.4g/mol CAS Number: 859216-15-2 Further references Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid re..
£44.00
Ex Tax:£36.67
Synonyms: Cibinetide, ARA-290, PHBSP Sequence: XEQLERALNSSIUPAC Condensed: H-Pyr-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser-OH Molecular Weight:  1257.3 g/mol CAS Number: 1208243-50-8 PubChem CID: 91810664 Further referencesPubChem  ..
£40.00
Ex Tax:£33.33
BACTERIOSTATIC WATER - 10ml Due to the continuing shortage of Hospira products, we are now stocking unbranded Bacteriostatic Water. This product has been produced for us in a sterile packing facility in the UK, using pharmaceutical grade materials. DESCRIPTION The following preparation is d..
£7.50
Ex Tax:£6.25
BACTERIOSTATIC WATER - 30ml Due to the continuing shortage of Hospira products, we are now stocking unbranded Bacteriostatic Water. This product has been produced for us in a sterile packing facility in the UK, using pharmaceutical grade materials. DESCRIPTION The following preparation is d..
£14.99
Ex Tax:£12.49
Unveiling the Potential of BPC-157: Exploring a Fascinating Peptide Introduction: In the realm of scientific exploration, peptides have emerged as intriguing compounds with diverse potential applications. Among them, BPC-157, known for its interesting properties, is drawing attention for i..
£13.99
Ex Tax:£11.66
CJC-1295 with DAC, also known as DAC:GRF (short for drug affinity complex:growth hormone-releasing factor), is a synthetic analogue of growth hormone-releasing hormone (GHRH) (also known as growth hormone-releasing factor (GRF)) and a growth hormone secretagogue (GHS). It is a modified form of Modif..
£21.75
Ex Tax:£18.13
Synonyms: delta Sleep-inducing peptide phosphate, Dsip-P Sequence: WAGGDAXGEIUPAC Condensed: H-Trp-Ala-Gly-Gly-Asp-Ala-Ser(PO3H2)-Gly-Glu-OH Molecular Weight:  928.8 g/mol CAS Number: 62568-57-4 PubChem CID: 172600 Further referencesPubChem..
£15.00
Ex Tax:£12.50
Epitalon is a synthetic tetra-peptide version of epithalamin (epithalon tetra), which is naturally produced by the pineal gland in the brain. Synonyms: Epitalon, Epithalon, Epithalone Sequence: AEDGIUPAC Condensed: H-Ala-Glu-Asp-Gly-OH Molecular Weight:  390.3..
£17.50
Ex Tax:£14.58
 Synonyms: activin-binding protein, GTPL4933, Activin-Binding Protein, FSH-Suppressing Protein, FST Sequence: MVRARHQPGG LCLLLLLLCQ FMEDRSAQAG NCWL RQAKNG RCQVLYKTEL SKEECCSTGR LSTSWTEEDV NDNTLFKWMI FNGGAPNCIP CKETCENVDC GPGKKCRMNK KNKPRCVCAP DCSNITWKGP VCGLDGKTYR NECALLKARC..
£75.00
Ex Tax:£62.50
 Synonyms: Somatotropin (176-191), Hgh (176-191), DTXSID10216216 Sequence: YLRIVQCRSVEGSCGFIUPAC Condensed: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Molecular Weight:  1799.1 g/mol CAS Number: 66004-57-7 PubChem CID:&..
£14.40
Ex Tax:£12.00
 Synonyms: Somatotropin (176-191), Hgh (176-191), DTXSID10216216 Sequence: YLRIVQCRSVEGSCGFIUPAC Condensed: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Molecular Weight:  1799.1 g/mol CAS Number: 66004-57-7 PubChem CID:&..
£28.50
Ex Tax:£23.75
 Synonyms: Copper tripeptide, GHK-CuGHK-Cu, HY-P0063 Sequence: IUPAC Condensed: Gly-His-Lys•Cu•xHOA Molecular Weight:  340.38 g/mol CAS Number: 89030-95-5 PubChem CID: 139035031 Further referencesPubChemWikipedia Stability: S..
£24.95
Ex Tax:£20.79
GHRP-2 (Growth Hormone Releasing Peptide-2) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were developed to stimulate the release of growth hormone (GH) from the pituitary gland. GHRP-2 is believed to act on both pituitary and hypothalamic si..
£15.99
Ex Tax:£13.33
GHRP-2 (Growth Hormone Releasing Peptide-2) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were developed to stimulate the release of growth hormone (GH) from the pituitary gland. GHRP-2 is believed to act on both pituitary and hypothalamic si..
£9.50
Ex Tax:£7.92
GHRP-6, which stands for Growth Hormone Releasing Peptide-6, is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were originally developed to stimulate the release of growth hormone (GH) from the anterior pituitary. Synonyms: SK&F-110..
£15.99
Ex Tax:£13.33
GHRP-6, which stands for Growth Hormone Releasing Peptide-6, is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were originally developed to stimulate the release of growth hormone (GH) from the anterior pituitary. Synonyms: SK&F-110..
£9.50
Ex Tax:£7.92
 Synonyms: Arvekap, (D-Trp6)-GnRH, Triptoreline Sequence: XHWSYWLRPGIUPAC Condensed: H-Pyr-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH2 Molecular Weight:  1311.4 g/mol CAS Number: 57773-63-4 PubChem CID: 25074470 Further referencesPubChem..
£10.00
Ex Tax:£8.33
 Synonyms: Examorelin, Examorelin [INN], EP-23905 Sequence: HXAWFKIUPAC Condensed: H-His-D-Trp(2-Me)-Ala-Trp-D-Phe-Lys-NH2 Molecular Weight:  887.0 g/mol CAS Number: 140703-51-1 PubChem CID: 6918297 Further referencesPubChem Stabi..
£12.00
Ex Tax:£10.00
Gonadotropins are protein hormones secreted by gonadotrope cells of the anterior pituitary of vertebrates. This is a family of proteins, which include the mammalian hormones Follicle-stimulating hormone (FSH), Luteinizing hormone (LH), placental chorionic gonadotropins hCG and eCG and chorionic gona..
£32.50
Ex Tax:£27.08
Mixing Solution - Genuine Hospira Bacteriostatic Water - 30ml Yet again, there is a worldwide shortage of Hospira Bacteriostatic Water. We have managed to secure a supply, but unfortunately the wholesale prices have rocketed and we have to reflect this . Hopefully sanity will return o..
£25.50
Ex Tax:£21.25
Long arginine 3-IGF-1 is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 ..
£9.99
Ex Tax:£8.33
Long arginine 3-IGF-1 is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 ..
£49.00
Ex Tax:£40.83
IGF1 (1-3) DES refers to a specific variant or fragment of the insulin-like growth factor 1 (IGF-1) protein. In this context, "(1-3) DES" indicates that the first three amino acids of the IGF-1 protein have been removed or truncated. Synonyms: IGF-DES 1.3, Insulin-like growth factor 1, des..
£49.00
Ex Tax:£40.83
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
£12.99
Ex Tax:£10.83
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
£9.50
Ex Tax:£7.92
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
£28.99
Ex Tax:£24.16
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
£21.00
Ex Tax:£17.50
Kisspeptin is a neuropeptide that plays a crucial role in regulating reproductive function, particularly in controlling the release of hormones like gonadotropin-releasing hormone (GnRH) and, subsequently, luteinizing hormone (LH) and follicle-stimulating hormone (FSH).Interesting fact… Kisspeptin w..
£21.50
Ex Tax:£17.92
Exploring Peptide KPV: A Versatile Molecular Marvel Introduction In the realm of scientific exploration, peptides have emerged as fascinating molecules with a myriad of potential applications. One such peptide that has garnered attention is KPV, a three-amino acid sequence that is generati..
£21.50
Ex Tax:£17.92
The Versatile LL-37 Peptide: A Defender with Multiple Functions Introduction: In the constantly evolving world of biotechnology, researchers have identified a promising peptide called LL-37. This peptide has garnered attention due to its multifaceted roles within our immune system. In this..
£30.00
Ex Tax:£25.00
Mechano Growth Factor (MGF) is a member of the IGF-1 (insulin-like Growth Factor 1) super family. MGF, also called IGF-1Ec, has a unique E domain with a 49bp insert in humans (52bp in rodents; IGF-1Eb), which results in a reading frame shift during the IGF-1 gene splicing to produce a distinct matur..
£12.00
Ex Tax:£10.00
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
£20.99
Ex Tax:£17.49
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
£12.95
Ex Tax:£10.79
Premium Modified GRF (1-29) 5mg (aka CJC-1295 w/o DAC) Premium Modified GRF (1-29) 5mg (aka CJC-1295 w/o DAC)
-30 %
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
£32.50 £46.50
Ex Tax:£27.08
MOTS-c is a 16-amino acid peptide encoded within the 12SrRNA region of mtDNA and is a member of the larger group of mitochondrial derived peptides (MDPs). MDPs have been shown to play a cytoprotective role by helping to preserve mitochondrial function and cell viability under stressful conditions.&n..
£19.50
Ex Tax:£16.25
Pegylated Mechano-growth factor (PEG-MGF) is a truncated and slightly altered form of insulin-like growth factor 1 (IGF-1). Pegylation is a process of attaching polyethylene glycol to another chemical compound. It is often done to reduce the body’s natural immune reaction to an agent or, as in ..
£21.75
Ex Tax:£18.13
 Synonyms: Bremelanotide, Bremelanotide [USAN:INN] Sequence: IUPAC Condensed: Ac-Nle-Asp(1)-His-D-Phe-Arg-Trp-Lys(1)-OH Molecular Weight: 1025.2 g/mol CAS Number: 189691-06-3 PubChem CID: 9941379 Further referencesPubChem Stabilit..
£20.00
Ex Tax:£16.67
 Synonyms: Selank,  Selanc, TP-7 Sequence: TKPRPGPIUPAC Condensed: H-Thr-Lys-Pro-Arg-Pro-Gly-Pro-OH Molecular Weight:  751.9 g/mol CAS Number: 129954-34-3 PubChem CID: 11765600 Further referencesPubChem Stability:&n..
£14.50
Ex Tax:£12.08
Semax is a peptide best known for its neuroprotective and neurogenic/neurorestorative properties. It was developed based on the molecular structure of adrenocorticotropic hormone (ACTH). Semax was developed in Russia by the Institute of Molecular Genetics at the Russian Academy of Sciences. It was i..
£19.00
Ex Tax:£15.83
 Synonyms: SNAP-8, SNAP8 Sequence: EEMQRRADIUPAC Condensed: Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH2 Molecular Weight:  1075.2 g/mol CAS Number: 868844-74-0 PubChem CID: 76283482 Further referencesPubChem Stability: Store ..
£21.95
Ex Tax:£18.29
Tesamorelin consists of the 44 amino acid sequence of human growth hormone releasing factor (GRF), with a 3-hexenoyl group attached to its tyrosine N-terminal residue. Synonyms: Egrifta, TH9507 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLIUPAC Condensed: Unk-Tyr-Al..
£24.00
Ex Tax:£20.00
Thymalin is believed to be involved in T-cell differentiation and enhancement of T and NK cell actions. Synonyms: Thymulin, Thymalin, 9H198D04WL Sequence: XAKSQGGSNIUPAC Condensed:    H-Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH Molecular Weight:  8..
£35.00
Ex Tax:£29.17
Thymalin is believed to be involved in T-cell differentiation and enhancement of T and NK cell actions. Synonyms: Thymulin, Thymalin, 9H198D04WL Sequence: XAKSQGGSNIUPAC Condensed:    H-Pyr-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH Molecular Weight:  8..
£45.00
Ex Tax:£37.50
A 28 amino acid sequence peptide, first isolated in 1977. It is derived from prothymosin alpha, a protein that in humans is encoded by the PTMA gene and is produced by stromal cells in the human Thymus.t was the first of the peptides from Thymosin Fraction 5 to be completely sequenced and synthesize..
£44.00
Ex Tax:£36.67
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
£26.99
Ex Tax:£22.49
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
£16.00
Ex Tax:£13.33
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
£59.99
Ex Tax:£49.99
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
£36.00
Ex Tax:£30.00
A novel research peptide - email us for more information.Stability:Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable..
£26.99
Ex Tax:£22.49
Vasoactive Intestinal Peptide (VIP) is a 28-amino acid polypeptide that plays a significant role in various physiological processes throughout the body. VIP is produced by neurons in the central nervous system, particularly in the hypothalamus, as well as by neurons in the gastrointestinal tract, pa..
£40.00
Ex Tax:£33.33
Exploring the Potential of Peptide Vesugen: A Promising Scientific Discovery Introduction The peptide Vesugen has garnered significant attention in the field of vascular and neurological health. This synthetic peptide complex is believed to support the normalization of blood vessel functio..
£35.00
Ex Tax:£29.17
Synonyms: Lysylglutamic acid, Lys-Glu, Normophthal Sequence: KEIUPAC Condensed: H-Lys-Glu-OH Molecular Weight:  275.3 g/mol CAS Number: 45234-02-4 PubChem CID: 7010502 Further referencesPubChem Stability: Store lyophilised pr..
£35.00
Ex Tax:£29.17
Showing 1 to 54 of 54 (1 Pages)