Similar to Ethanol and water, Acetic Acid is a protic (polar) solvent. This means that it dissolves both polar compounds, like salts and sugars, but also non-polar compounds, such as oils.Peptide solubility characteristics vary strongly from one peptide to another. Residues such as Ala, Cys, Ile, Le..
Synonyms: Adipotide, FTPP Sequence: CKGGRAKDC-GG-D(KLAKLAK)2 Molecular Weight: 2611.4g/mol CAS Number: 859216-15-2 Further references Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid re..
ARA-290 is a synthetic peptide engineered to mimic the beneficial effects of erythropoietin (EPO) in tissue protection, repair, and anti-inflammatory actions without stimulating red blood cell production. This innovative peptide is designed to harness the healing and regenerative capabilities of the..
BACTERIOSTATIC WATER - 10ml
Due to the continuing shortage of Hospira products, we are now stocking unbranded Bacteriostatic Water. This product has been produced for us in a sterile packing facility in the UK, using pharmaceutical grade materials.
DESCRIPTION
Bacteriostatic Water is a ster..
BACTERIOSTATIC WATER - 30ml
Due to the continuing shortage of Hospira products, we are now stocking unbranded Bacteriostatic Water. This product has been produced for us in a sterile packing facility in the UK, using pharmaceutical grade materials.
DESCRIPTION
Due to the continuing shortage..
Unveiling the Potential of BPC-157: Exploring a Fascinating Peptide Introduction: In the realm of scientific exploration, peptides have emerged as intriguing compounds with diverse potential applications. Among them, BPC-157, known for its interesting properties, is drawing attention for i..
CJC-1295 with DAC, also known as DAC:GRF (short for drug affinity complex:growth hormone-releasing factor), is a synthetic analogue of growth hormone-releasing hormone (GHRH) (also known as growth hormone-releasing factor (GRF)) and a growth hormone secretagogue (GHS). It is a modified form of Modif..
Epitalon, also known as Epithalon or Epithalamin, is a synthetic tetrapeptide, meaning it is composed of four amino acid residues. It is designed to mimic a natural peptide, Epithalamin, extracted from the pineal gland of animals. The peptide has garnered attention within the scientific and wellness..
GHK-Cu, also known as Copper Tripeptide-1, represents a fusion of nature and scientific innovation, encapsulating a small yet powerful molecule that has sparked interest across cosmetic, dermatological, and wellness communities. This peptide, a complex of the amino acids glycine, histidine, and lysi..
GHRP-2 (Growth Hormone Releasing Peptide-2) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were developed to stimulate the release of growth hormone (GH) from the pituitary gland. GHRP-2 is believed to act on both pituitary and hypothalamic si..
GHRP-2 (Growth Hormone Releasing Peptide-2) is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were developed to stimulate the release of growth hormone (GH) from the pituitary gland. GHRP-2 is believed to act on both pituitary and hypothalamic si..
GHRP-6, which stands for Growth Hormone Releasing Peptide-6, is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were originally developed to stimulate the release of growth hormone (GH) from the anterior pituitary. Synonyms: SK&F-110..
GHRP-6, which stands for Growth Hormone Releasing Peptide-6, is one of several synthetic met-enkephalin analogs that include unnatural D-amino acids. These peptides were originally developed to stimulate the release of growth hormone (GH) from the anterior pituitary. Synonyms: SK&F-110..
Gonadotropins are protein hormones secreted by gonadotrope cells of the anterior pituitary of vertebrates. This is a family of proteins, which include the mammalian hormones Follicle-stimulating hormone (FSH), Luteinizing hormone (LH), placental chorionic gonadotropins hCG and eCG and chorionic gona..
Mixing Solution - Genuine Hospira Bacteriostatic Water - 30ml
Yet again, there is a worldwide shortage of Hospira Bacteriostatic Water. We have managed to secure a supply, but unfortunately the wholesale prices have rocketed and we have to reflect this . Hopefully sanity will return o..
Long arginine 3-IGF-1 is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 ..
Long arginine 3-IGF-1 is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 ..
IGF1 (1-3) DES refers to a specific variant or fragment of the insulin-like growth factor 1 (IGF-1) protein. In this context, "(1-3) DES" indicates that the first three amino acids of the IGF-1 protein have been removed or truncated. Synonyms: IGF-DES 1.3, Insulin-like growth factor 1, des..
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
Unlocking the Potential of Ipamorelin: Exploring a Promising Peptide In the realm of scientific innovation, peptides have emerged as intriguing compounds with diverse potential applications. Among them, Ipamorelin stands out for its unique properties and possible therapeutic uses. Understa..
Kisspeptin is a neuropeptide that plays a crucial role in regulating reproductive function, particularly in controlling the release of hormones like gonadotropin-releasing hormone (GnRH) and, subsequently, luteinizing hormone (LH) and follicle-stimulating hormone (FSH).Interesting fact… Kisspeptin w..
Exploring Peptide KPV: A Versatile Molecular Marvel Introduction In the realm of scientific exploration, peptides have emerged as fascinating molecules with a myriad of potential applications. One such peptide that has garnered attention is KPV, a three-amino acid sequence that is generati..
The Versatile LL-37 Peptide: A Defender with Multiple Functions Introduction: In the constantly evolving world of biotechnology, researchers have identified a promising peptide called LL-37. This peptide has garnered attention due to its multifaceted roles within our immune system. In this..
Mechano Growth Factor (MGF) is a member of the IGF-1 (insulin-like Growth Factor 1) super family. MGF, also called IGF-1Ec, has a unique E domain with a 49bp insert in humans (52bp in rodents; IGF-1Eb), which results in a reading frame shift during the IGF-1 gene splicing to produce a distinct matur..
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
Exploring Modified GRF (1-29), also known as CJC-1295 without DAC Introduction:In the field of biochemistry, peptides are gaining attention for potential applications in various areas. One such peptide, Modified-GRF, has drawn interest from researchers investigating areas such as anti-aging, mu..
MOTS-c 5mgMOTS-c is a cutting-edge peptide, gaining recognition for its role in metabolic regulation and potential health benefits. It is a 16-amino acid peptide encoded within the 12SrRNA region of mtDNA and is a member of the larger group of mitochondrial derived peptides (MDPs). As an MDP, MOTS-c..
MOTS-c 10mgMOTS-c is a cutting-edge peptide, gaining recognition for its role in metabolic regulation and potential health benefits. It is a 16-amino acid peptide encoded within the 12SrRNA region of mtDNA and is a member of the larger group of mitochondrial derived peptides (MDPs). As an MDP, MOTS-..
Pegylated Mechano-growth factor (PEG-MGF) is a truncated and slightly altered form of insulin-like growth factor 1 (IGF-1). Pegylation is a process of attaching polyethylene glycol to another chemical compound. It is often done to reduce the body’s natural immune reaction to an agent or, as in ..
Semax is a peptide best known for its neuroprotective and neurogenic/neurorestorative properties. It was developed based on the molecular structure of adrenocorticotropic hormone (ACTH). Semax was developed in Russia by the Institute of Molecular Genetics at the Russian Academy of Sciences. It was i..
Tesamorelin consists of the 44 amino acid sequence of human growth hormone releasing factor (GRF), with a 3-hexenoyl group attached to its tyrosine N-terminal residue. Synonyms: Egrifta, TH9507 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLIUPAC Condensed: Unk-Tyr-Al..
Thymalin is a synthetic peptide, originally derived from the thymus gland, a key organ in the human immune system. Its design reflects a deep understanding of the thymus's role in immune regulation, aiming to harness these properties to support general well-being. Thymalin is comprised of a sequence..
Thymalin is a synthetic peptide, originally derived from the thymus gland, a key organ in the human immune system. Its design reflects a deep understanding of the thymus's role in immune regulation, aiming to harness these properties to support general well-being. Thymalin is comprised of a sequence..
A 28 amino acid sequence peptide, first isolated in 1977. It is derived from prothymosin alpha, a protein that in humans is encoded by the PTMA gene and is produced by stromal cells in the human Thymus.t was the first of the peptides from Thymosin Fraction 5 to be completely sequenced and synthesize..
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
Exploring the Potential of TB500: A Versatile Peptide In the realm of performance enhancement and recovery, researchers are continually searching for innovative solutions to support well-being. One substance that has captured attention recently is TB500, a peptide with intriguing properties. Le..
A novel research peptide - email us for more information.Stability:Store lyophilized protein at -20 °C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 °C for a limited period of time. The lyophilized protein remains stable..
Vasoactive Intestinal Peptide (VIP) is a 28-amino acid polypeptide that plays a significant role in various physiological processes throughout the body. VIP is produced by neurons in the central nervous system, particularly in the hypothalamus, as well as by neurons in the gastrointestinal tract, pa..
Exploring the Potential of Peptide Vesugen: A Promising Scientific Discovery Introduction The peptide Vesugen has garnered significant attention in the field of vascular and neurological health. This synthetic peptide complex is believed to support the normalization of blood vessel functio..