Menu
Your Cart
Free shipping on UK orders over £50
Expert UK Customer Service
Research Quality - Assured

Thymosin Beta 4 5mg (TB500)

Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
Thymosin Beta 4 5mg (TB500)
£36.00
Ex Tax: £30.00
  • Stock: In Stock
  • Model: US-TB500-5mg
  • Weight: 6.00g
  • JAN: Orange top

B500 is a synthetic version of the naturally occurring peptide present in virtually all human and animal cells, Thymosin Beta-4. It plays a role in the regulation of actin, which is a cell-building protein.

 

Synonyms: Thymosin beta 4, Timbetasin

 

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

IUPAC Condensed: Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

 

Molecular Weight:  4963 g/mol

 

CAS Number: 77591-33-4

 

PubChem CID: 16132341

 

Further references

PubChem https://pubchem.ncbi.nlm.nih.gov/compound/16132341

 

Stability: Store lyophilised protein at -20°c. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°c for a limited period of time. The lyophilised protein remains stable until expiry date when stored at -20°c.

 

Source: Biosynthesis

 

Reconstitution: Reconstitute with Bacteriostatic Water

 

Usage: Product is prepared for LABORATORY RESEARCH ONLY. TB500 for sale at Pure Peptides UK is limited to scientific research and education only – Only buy TB500 if you are a licenced researcher.

Write a review

Note: HTML is not translated!
Bad Good
Captcha